Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Claudin-11 (Cldn11)

This Recombinant Mouse Claudin-11 (Cldn11) spans the amino acid sequence from region 1-207.

Product Specifications

Product Name Alternative

Claudin-11, Oligodendrocyte transmembrane protein, Oligodendrocyte-specific protein

UniProt

Q60771

Expression Region

1-207

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVATCLQVVGFVTSFVGWIGIIVTTSTNDWVVTCSYTIPTCRKMDELGSKGLWADCVMAT GLYHCKPLVDILILPGYVQACRALMIAASVLGLPAILLLLTVLPCIRMGHEPGVAKYRRA QLAGVLLILLALCAIVATIWFPVCAHREITIVSFGYSLYAGWIGAVMCLVGGCVIVCCSG DAQSFGENRFYYSSGSSSPTHAKSAHV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SP1 Rabbit Polyclonal Antibody
orb443221 100 µg

SP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TSPO2 siRNA (Human)
orb1851687-01 15 nmol

TSPO2 siRNA (Human)

Sign In for Pricing
View Details
TSPO2 siRNA (Human)
orb1851687-02 30 nmol

TSPO2 siRNA (Human)

Sign In for Pricing
View Details
Olfr770 shRNA Plasmid (m)
sc-151118-SH 20 µg

Olfr770 shRNA Plasmid (m)

Sign In for Pricing
View Details
Mini Dialysis Kit 1 kDa cutoff 250 ul
80648375 1 Each

Mini Dialysis Kit 1 kDa cutoff 250 ul

Sign In for Pricing
View Details
ZNF138 Antibody - C-terminal region
ARP47606_P050-25UL 25 µL

ZNF138 Antibody - C-terminal region

Sign In for Pricing
View Details