Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Claudin-11 (Cldn11)

This Recombinant Mouse Claudin-11 (Cldn11) spans the amino acid sequence from region 1-207.

Product Specifications

Product Name Alternative

Claudin-11, Oligodendrocyte transmembrane protein, Oligodendrocyte-specific protein

UniProt

Q60771

Expression Region

1-207

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVATCLQVVGFVTSFVGWIGIIVTTSTNDWVVTCSYTIPTCRKMDELGSKGLWADCVMAT GLYHCKPLVDILILPGYVQACRALMIAASVLGLPAILLLLTVLPCIRMGHEPGVAKYRRA QLAGVLLILLALCAIVATIWFPVCAHREITIVSFGYSLYAGWIGAVMCLVGGCVIVCCSG DAQSFGENRFYYSSGSSSPTHAKSAHV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P2Y2
P10139 50 µg Blocking Peptide

P2Y2

Sign In for Pricing
View Details
RN7SKP6 Protein Vector (Human) (pPM-C-His)
PV118041 500 ng

RN7SKP6 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Monoamine Oxidase (MAO) Rat ELISA Kit
F0761 96 Tests

Monoamine Oxidase (MAO) Rat ELISA Kit

Sign In for Pricing
View Details
Cortactin Rabbit Polyclonal Antibody
orb216098-01 30 µL

Cortactin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cortactin Rabbit Polyclonal Antibody
orb216098-02 50 μL

Cortactin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cortactin Rabbit Polyclonal Antibody
orb216098-03 100 µL

Cortactin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details