Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome c oxidase subunit 1 (COI)

This Recombinant Cytochrome c oxidase subunit 1 (COI) spans the amino acid sequence from region 1-207.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 1, EC= 1.9.3.1, Cytochrome c oxidase polypeptide I

UniProt

Q9TGD8

Expression Region

1-207

Origin

Planctoteuthis danae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

IFGIWAGLLGTSLSLMIRTELGQPGSLLNDDQLYNVVVTAHGFIMIFFLVMPIMIGGFGN WLVPLMLGAPDMAFPRMNNMSFWLLPPSLTLLLASSAVESGAGTGWTVYPPLSSNLSHAG PSVDLAIFSLHLAGVSSILGAINFITTILNMRWEGLQMERLPLFVWSVFITAILLLLSLP VLAGAITMLLTDRNFNTTFFDPSGGGD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCRO Polyclonal Antibody, Cy5 Conjugated
bs-6523R-Cy5 100 µL

SCRO Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
AV-412 100mg
A11028-100 100 mg

AV-412 100mg

Sign In for Pricing
View Details
Human Charged multivesicular body protein 1b, CHMP1B ELISA KIT
ELI-33701h 96 Tests

Human Charged multivesicular body protein 1b, CHMP1B ELISA KIT

Sign In for Pricing
View Details
Lentiviral mouse Lce1a2 shRNA (UAS) - Lentiviral mouse Lce1a2 shRNA (UAS, RFP) plasmid
GTR15183301 1 Vial

Lentiviral mouse Lce1a2 shRNA (UAS) - Lentiviral mouse Lce1a2 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
AKT3 Antibody
DF2654-01 100 µL

AKT3 Antibody

Sign In for Pricing
View Details
AKT3 Antibody
DF2654-02 200 µL

AKT3 Antibody

Sign In for Pricing
View Details