Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome c oxidase subunit 1 (COI)

This Recombinant Cytochrome c oxidase subunit 1 (COI) spans the amino acid sequence from region 1-207.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 1, EC= 1.9.3.1, Cytochrome c oxidase polypeptide I

UniProt

Q9TGD8

Expression Region

1-207

Origin

Planctoteuthis danae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

IFGIWAGLLGTSLSLMIRTELGQPGSLLNDDQLYNVVVTAHGFIMIFFLVMPIMIGGFGN WLVPLMLGAPDMAFPRMNNMSFWLLPPSLTLLLASSAVESGAGTGWTVYPPLSSNLSHAG PSVDLAIFSLHLAGVSSILGAINFITTILNMRWEGLQMERLPLFVWSVFITAILLLLSLP VLAGAITMLLTDRNFNTTFFDPSGGGD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2- (Adamantan-1-ylformamido) acetic acid
WAA24141-01 0.5 g

2- (Adamantan-1-ylformamido) acetic acid

Sign In for Pricing
View Details
2- (Adamantan-1-ylformamido) acetic acid
WAA24141-02 5 g

2- (Adamantan-1-ylformamido) acetic acid

Sign In for Pricing
View Details
Recombinant Pyemotes tritici Toxin TxP-I
MBS1165827-01 0.02 mg (E-Coli)

Recombinant Pyemotes tritici Toxin TxP-I

Sign In for Pricing
View Details
Recombinant Pyemotes tritici Toxin TxP-I
MBS1165827-02 0.1 mg (E-Coli)

Recombinant Pyemotes tritici Toxin TxP-I

Sign In for Pricing
View Details
Recombinant Pyemotes tritici Toxin TxP-I
MBS1165827-03 0.02 mg (Yeast)

Recombinant Pyemotes tritici Toxin TxP-I

Sign In for Pricing
View Details
Recombinant Pyemotes tritici Toxin TxP-I
MBS1165827-04 0.1 mg (Yeast)

Recombinant Pyemotes tritici Toxin TxP-I

Sign In for Pricing
View Details