Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Cytochrome c oxidase subunit 3 (ctaE)

This Recombinant Bacillus subtilis Cytochrome c oxidase subunit 3 (ctaE) spans the amino acid sequence from region 1-207.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 3, EC= 1.9.3.1, Caa-3605 subunit 3, Cytochrome aa3 subunit 3, Cytochrome c oxidase polypeptide III, Oxidase aa (3) subunit 3

UniProt

P24012

Expression Region

1-207

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQVQEKFTAETFPASPEKVTLEGKNKFLGFWLFLGGETVLFASLFATFLALRNSNAGDPP TTEMFDVTLVFIATMLLLTSSLTSVYAMYHMKNFSFGKMQLWLGITILLGAGFLGLEIYE FKHYTHEFGFTITSSALGSAFYTLVGTHGAHVAFGLMWISTLMIRNAKRGLNLYTAPKFY VASLYWHFIDVVWVFIFTVVYLMGMVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL
BNC041050-100 1x 100 µL

CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF405S conjugate, 0.1mg/mL
BNC040012-100 1x 100 µL

Tyrosinase (T311), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405S conjugate, 0.1mg/mL
BNC041429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF647 conjugate, 0.1mg/mL
BNC470152-500 1x 500 µL

CD11c (HC1/1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF770 conjugate, 0.1mg/mL
BNC700160-500 1x 500 µL

CD20 (B9E9), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (Rabbit PAb), CF640R conjugate, 0.1mg/mL
BNC400385-100 1x 100 µL

CD3e (Rabbit PAb), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details