Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Glycine max CASP-like protein 11

This Recombinant Glycine max CASP-like protein 11 spans the amino acid sequence from region 1-208.

Product Specifications

Product Name Alternative

CASP-like protein 11

UniProt

C6SYW3

Expression Region

1-208

Origin

Glycine max (Soybean) (Glycine hispida)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEERSGVLETSRSCKQLIGPEGSDKEFEGYIDSNLRVVETFLRLFPIGLCVTALVIMLKN SQENKYGSVSYTDLGAFRYLVHANGICAGYSLFSAIFVALPRLSSVHIAWTFFVLDQVLT YIILSAGAASAEVLYLAEKGNMATAWSSACRSFGPFCHKVTASTTITFVVVVFYVLLSLI SSYKLFSKYDAPTVSNPSMGADIVAFHG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

trans-2,cis-6-Nonadienal-D5 (>90%)
TRC-N649368-1MG 1 mg

trans-2,cis-6-Nonadienal-D5 (>90%)

Sign In for Pricing
View Details
Biotin Conjugated Sheep Affinity Purified Antibody to Mouse IgG,
BAF-611-1 1 mL

Biotin Conjugated Sheep Affinity Purified Antibody to Mouse IgG,

Sign In for Pricing
View Details
3,5-Dibromo-4-hydroxybenzoic Acid
TRC-D425615-25G 25 g

3,5-Dibromo-4-hydroxybenzoic Acid

Sign In for Pricing
View Details
Sodium Metasilicate
TRC-S224405-5G 5 g

Sodium Metasilicate

Sign In for Pricing
View Details
1-(4-tert-Butylphenyl)-4-chloro-1-butanone
TRC-B690930-5G 5 g

1-(4-tert-Butylphenyl)-4-chloro-1-butanone

Sign In for Pricing
View Details
Shisa2 Mouse Gene Knockout Kit (CRISPR)
KN515750 1 Kit

Shisa2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details