Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pacifastacus leniusculus Astakine

Product Specifications

Product Name Alternative

(Prokineticin-like cytokine)

Abbreviation

Recombinant Pacifastacus leniusculus Astakine protein

UniProt

Q56R11

Expression Region

23-104aa

Organism

Pacifastacus leniusculus (Signal crayfish)

Target Sequence

GSCNSQEPDCGPSECCLQGWMRYSTRGCAPLGEAGSSCNVFTQAPVKGFYIGMCPCRAGLVCTRPSATCQLPSQDNTLDSYY

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Cytokine directly involved in hematopoiesis.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

16.2 kDa

References & Citations

"An ancient role for a prokineticin domain in invertebrate hematopoiesis." Soderhall I., Kim Y.-A., Jiravanichpaisal P., Lee S.-Y., Soderhall K. J. Immunol. 174:6153-6160 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fenpiverinium Bromide
TRC-F249000-10MG 10 mg

Fenpiverinium Bromide

Sign In for Pricing
View Details
Mouse Dst activation kit by CRISPRa
GA201141 1 Kit

Mouse Dst activation kit by CRISPRa

Sign In for Pricing
View Details
Uridine-13C,15N2 2',3',5'-Tribenzoate
TRC-U830047-2.5MG 2.5 mg

Uridine-13C,15N2 2',3',5'-Tribenzoate

Sign In for Pricing
View Details
3-Chloro-5-fluorobenzoic acid
TRC-C584780-500MG 500 mg

3-Chloro-5-fluorobenzoic acid

Sign In for Pricing
View Details
SUMO-2/3 (SM23/496), CF405S conjugate, 0.1mg/mL
BNC040496-100 1x 100 µL

SUMO-2/3 (SM23/496), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human WNT10A activation kit by CRISPRa
GA112926 1 Kit

Human WNT10A activation kit by CRISPRa

Sign In for Pricing
View Details