Recombinant Mouse Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 2 (Nkain2)

Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 2, Na (+) /K (+) -transporting ATPase subunit beta-1-interacting protein 2, T-cell lymphoma breakpoint-associated target pr

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

MGYCSGRCTLIFICGMQLVCVLERQIFDFLGYQWAPILANFVHIIIVILGLFGTIQYRPR YVTGYAVWLVLWVTWNVFVICFYLEAGDLSKETDLILTFNISMHRSWWMENGPGCMVTSV TPAPDWAPEDHRYITVSGCFLDYQYIEVAHSSLQIVLALAGFIYACYVVRCITEEEDSFD FIGGFDSYGYQGPQKTSHLQLQPMYMSK