Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta (Rhesus macaque) Platelet-activating factor receptor (PTAFR)

This Recombinant Macaca mulatta (Rhesus macaque) Platelet-activating factor receptor (PTAFR) spans the amino acid sequence from region 1-208.

Product Specifications

Product Name Alternative

Platelet-activating factor receptor, PAF-R, PAFr

UniProt

P35366

Expression Region

1-208

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPHDSSHVDSEFRYTLFPIVYSIIFVLGVIANGYVLWVFARLYPSKKFNEIKIFMVNLT MADMLFLITLPLWIVYYQNGGNWIFPKFLCNLAGCLFFINTYCSVAFLGVITYNRFQAVT RPIKTAQANTRKRGISLSLVIWVAIVGAASYFFILDSTNTVPNSAGSGNITRCFEHYEKG SVPVLIIHIFIVFSFFLVFLIILFCNLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRPK2 (C-term) Rabbit Polyclonal Antibody
AP14192PU-N 400 µL

SRPK2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Diels' Acid
TRC-D228425-100MG 100 mg

Diels' Acid

Sign In for Pricing
View Details
Chlorhexidine EP Impurity O
TRC-C729840-100MG 100 mg

Chlorhexidine EP Impurity O

Sign In for Pricing
View Details
Human ELP6 activation kit by CRISPRa
GA110318 1 Kit

Human ELP6 activation kit by CRISPRa

Sign In for Pricing
View Details
Maltose Microplate Assay Kit
RDSM235 100 Assays

Maltose Microplate Assay Kit

Sign In for Pricing
View Details
5-(neo-Pentyl)hydantoin
TRC-P280150-500MG 500 mg

5-(neo-Pentyl)hydantoin

Sign In for Pricing
View Details