Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta (Rhesus macaque) Platelet-activating factor receptor (PTAFR)

This Recombinant Macaca mulatta (Rhesus macaque) Platelet-activating factor receptor (PTAFR) spans the amino acid sequence from region 1-208.

Product Specifications

Product Name Alternative

Platelet-activating factor receptor, PAF-R, PAFr

UniProt

P35366

Expression Region

1-208

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPHDSSHVDSEFRYTLFPIVYSIIFVLGVIANGYVLWVFARLYPSKKFNEIKIFMVNLT MADMLFLITLPLWIVYYQNGGNWIFPKFLCNLAGCLFFINTYCSVAFLGVITYNRFQAVT RPIKTAQANTRKRGISLSLVIWVAIVGAASYFFILDSTNTVPNSAGSGNITRCFEHYEKG SVPVLIIHIFIVFSFFLVFLIILFCNLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD80 (T-lymphocyte Activation Antigen CD80, Activation B7-1 Antigen, BB1, CTLA-4 Counter-receptor B7.1, B7, CD28LG, CD28LG1, LAB7) (MaxLight 490)
124687-ML490 100 µL

CD80 (T-lymphocyte Activation Antigen CD80, Activation B7-1 Antigen, BB1, CTLA-4 Counter-receptor B7.1, B7, CD28LG, CD28LG1, LAB7) (MaxLight 490)

Sign In for Pricing
View Details
PDE8B ORF Vector (Human) (pORF)
36298011 1.0 µg DNA

PDE8B ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
SLC9A9 Rabbit pAb (APR28119N)
APR28119N-01 50 µL

SLC9A9 Rabbit pAb (APR28119N)

Sign In for Pricing
View Details
SLC9A9 Rabbit pAb (APR28119N)
APR28119N-02 100 µL

SLC9A9 Rabbit pAb (APR28119N)

Sign In for Pricing
View Details
SLC9A9 Rabbit pAb (APR28119N)
APR28119N-03 200 µL

SLC9A9 Rabbit pAb (APR28119N)

Sign In for Pricing
View Details
TLR6 (Toll Like Receptor 6, Toll-like Receptor 6 Precursor, CD286, CD286 Antigen) (HRP)
T8050-53D-HRP 100 µL

TLR6 (Toll Like Receptor 6, Toll-like Receptor 6 Precursor, CD286, CD286 Antigen) (HRP)

Sign In for Pricing
View Details