Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nitratiruptor sp. Glycerol-3-phosphate acyltransferase (plsY)

This Recombinant Nitratiruptor sp. Glycerol-3-phosphate acyltransferase (plsY) spans the amino acid sequence from region 1-209.

Product Specifications

Product Name Alternative

Glycerol-3-phosphate acyltransferase, Acyl-PO4 G3P acyltransferase, Acyl-phosphate--glycerol-3-phosphate acyltransferase, G3P acyltransferase, GPAT, EC= 2.3.1.n3, Lysophosphati

UniProt

A6Q218

Expression Region

1-209

Origin

Nitratiruptor sp. (strain SB155-2)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDFFTNPNVLFYITAYLVGGIPFGYILAKIFAGVDIKQSGSKSIGATNVLRVVKEKDPKL AKKLAIATVVFDALKGAVLVLIAKLLGFPPATWWLIGIMTVLGHCYSPFLKFEGGKGVAT GMGVLLVLLPVETIIGIVTWLIVAKTTKISSLSSLSGLVALVVASFIVHPDMPYVHSHAP LLLLAFIIFYKHLPNIKRLLTGQEGKVAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF740 conjugate, 0.1mg/mL
BNC740965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF740 conjugate, 0.1mg/mL
BNC740146-500 1x 500 µL

CD10 (CB-CALLA), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF640R conjugate, 0.1mg/mL
BNC400096-100 1x 100 µL

Histone H1 (AE-4), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thyroglobulin (TGB04 + TGB05), CF740 conjugate, 0.1mg/mL
BNC741227-500 1x 500 µL

Thyroglobulin (TGB04 + TGB05), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pgp9.5 (UCHL-1) (UCHL1/841), CF647 conjugate, 0.1mg/mL
BNC470841-500 1x 500 µL

Pgp9.5 (UCHL-1) (UCHL1/841), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Beta-2-Microglobulin (B2M) (B2M/1118), CF488A conjugate, 0.1mg/mL
BNC881118-100 1x 100 µL

Beta-2-Microglobulin (B2M) (B2M/1118), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details