Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sodalis glossinidius Glycerol-3-phosphate acyltransferase (plsY)

This Recombinant Sodalis glossinidius Glycerol-3-phosphate acyltransferase (plsY) spans the amino acid sequence from region 1-209.

Product Specifications

Product Name Alternative

Glycerol-3-phosphate acyltransferase, Acyl-PO4 G3P acyltransferase, Acyl-phosphate--glycerol-3-phosphate acyltransferase, G3P acyltransferase, GPAT, EC= 2.3.1.n3, Lysophosphati

UniProt

Q2NWE5

Expression Region

1-209

Origin

Sodalis glossinidius (strain morsitans)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNAIAIGMIIFAYLCGSVSNAILICRLARLPDPRTSGSGNPGATNVLRLGGKLAAAGVMV FDVLKGMIPVWIGYGLGLPPFWLGLVAIAACLGHIYPIFFHFRGGKGVATALGAIAPIGY DLSGLMIGTWLLTALLSGYSSLGAIVSALIAPFYVWWFKPQFTFPVAMLSCLVLLRHHDN IQRLWHGQESRIWHRRQKDRDIDRQQSKH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD43 (84-3C1), CF405S conjugate, 0.1mg/mL
BNC040342-500 1x 500 µL

CD43 (84-3C1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF740 conjugate, 0.1mg/mL
BNC740871-100 1x 100 µL

CD71 (66IG10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF405S conjugate, 0.1mg/mL
BNC040965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1388), CF647 conjugate, 0.1mg/mL
BNC471388-500 1x 500 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1388), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thymidylate Synthase (5-FU Resistance Marker) (TYMS/1884), CF647 conjugate, 0.1mg/mL
BNC471884-100 1x 100 µL

Thymidylate Synthase (5-FU Resistance Marker) (TYMS/1884), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF568 conjugate, 0.1mg/mL
BNC680676-100 1x 100 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details