Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Claudin-4 (CLDN4)

This Recombinant Bovine Claudin-4 (CLDN4) spans the amino acid sequence from region 1-209.

Product Specifications

Product Name Alternative

Claudin-4

UniProt

Q6BBL6

Expression Region

1-209

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASMGLQVMGIALAVLGWLGAILSCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTG QMQCKVYDSLLALPQDLQAARALIVICIILAVFGVLLSVVGGKCTNCVDDESSKAKIMIV AGVVFLLAGLLVMVPVSWTANNVIRDFYNPLVASGQKREMGASLYVGWAAAGLLILGGAL LCFNCPPRNDKPYSAKYSAARSAPASNYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 Antibody
orb653478 100 µL

CD31 Antibody

Sign In for Pricing
View Details
Mouse Transmissible Gastroenteritis virus antibody (TGEV Ab) ELISA Kit
YP-W28287-01 48 Tests

Mouse Transmissible Gastroenteritis virus antibody (TGEV Ab) ELISA Kit

Sign In for Pricing
View Details
Mouse Transmissible Gastroenteritis virus antibody (TGEV Ab) ELISA Kit
YP-W28287-02 96 Tests

Mouse Transmissible Gastroenteritis virus antibody (TGEV Ab) ELISA Kit

Sign In for Pricing
View Details
PSMD1, NT (PSMD1, 26S proteasome non-ATPase regulatory subunit 1, 26S proteasome regulatory subunit RPN2, 26S proteasome regulatory subunit S1, 26S proteasome subunit p112) (MaxLight 750)
MBS6338236-01 0.1 mL

PSMD1, NT (PSMD1, 26S proteasome non-ATPase regulatory subunit 1, 26S proteasome regulatory subunit RPN2, 26S proteasome regulatory subunit S1, 26S proteasome subunit p112) (MaxLight 750)

Sign In for Pricing
View Details
PSMD1, NT (PSMD1, 26S proteasome non-ATPase regulatory subunit 1, 26S proteasome regulatory subunit RPN2, 26S proteasome regulatory subunit S1, 26S proteasome subunit p112) (MaxLight 750)
MBS6338236-02 5x 0.1 mL

PSMD1, NT (PSMD1, 26S proteasome non-ATPase regulatory subunit 1, 26S proteasome regulatory subunit RPN2, 26S proteasome regulatory subunit S1, 26S proteasome subunit p112) (MaxLight 750)

Sign In for Pricing
View Details
Flag Tag Mouse mAb (HRP)
orb1925039-01 100 µL

Flag Tag Mouse mAb (HRP)

Sign In for Pricing
View Details