Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Claudin-4 (CLDN4)

This Recombinant Bovine Claudin-4 (CLDN4) spans the amino acid sequence from region 1-209.

Product Specifications

Product Name Alternative

Claudin-4

UniProt

Q6BBL6

Expression Region

1-209

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASMGLQVMGIALAVLGWLGAILSCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTG QMQCKVYDSLLALPQDLQAARALIVICIILAVFGVLLSVVGGKCTNCVDDESSKAKIMIV AGVVFLLAGLLVMVPVSWTANNVIRDFYNPLVASGQKREMGASLYVGWAAAGLLILGGAL LCFNCPPRNDKPYSAKYSAARSAPASNYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Integrin beta 4/CD104 Antibody (UM-A9) [mFluor Violet 450 SE]
NBP2-34507MFV450 0.1 mL

Mouse Monoclonal Integrin beta 4/CD104 Antibody (UM-A9) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
CD46P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV720745 1.0 µg DNA

CD46P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
ZW10 (Centromere/kinetochore Protein zw10 Homolog, zw10 Kinetochore Protein, HZW10, KNTC1AP) (PE)
MBS6399359-01 0.1 mL

ZW10 (Centromere/kinetochore Protein zw10 Homolog, zw10 Kinetochore Protein, HZW10, KNTC1AP) (PE)

Sign In for Pricing
View Details
ZW10 (Centromere/kinetochore Protein zw10 Homolog, zw10 Kinetochore Protein, HZW10, KNTC1AP) (PE)
MBS6399359-02 5x 0.1 mL

ZW10 (Centromere/kinetochore Protein zw10 Homolog, zw10 Kinetochore Protein, HZW10, KNTC1AP) (PE)

Sign In for Pricing
View Details
OCTN1/2 (H-9) Alexa Fluor® 680
sc-515731 AF680 200 µg/mL

OCTN1/2 (H-9) Alexa Fluor® 680

Sign In for Pricing
View Details
SLC25A41 Protein Lysate (Human) with C-Ha Tag
44031031 100 µg

SLC25A41 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details