Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein yrhP (yrhP)

This Recombinant Bacillus subtilis Uncharacterized membrane protein yrhP (yrhP) spans the amino acid sequence from region 1-210.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yrhP

UniProt

O05406

Expression Region

1-210

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHSLLAYIPIAAMMVIIPGADTMLVMKNTLRYGPKAGRYNILGLATGLSFWTVIAILGLS VVIAKSVILFTTIKYLGAAYLIYLGVKSFFAKSMFSLDDMQSQAKNMASSPKRYYKTSFM QGSLSNILNPKTVLVYVTIMPQFINLNGNINQQLIILASILTLLAVLWFLFLVYIIDYAK KWMKNSKFQKVFQKITGIILVGFGIKTGLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WEE1 pSer123 Rabbit Polyclonal Antibody
AP12735PU-N 400 µL

WEE1 pSer123 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tris Hydrochloride (Tris-HCl), 1kg
PR0614-1kg 1 Kg

Tris Hydrochloride (Tris-HCl), 1kg

Sign In for Pricing
View Details
R Cadherin (CDH4) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B7]
TA804801BM 100 µL

R Cadherin (CDH4) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B7]

Sign In for Pricing
View Details
(2S)-2-Pentanamine Hydrochloride
TRC-S681758-50MG 50 mg

(2S)-2-Pentanamine Hydrochloride

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS800694 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
CA150 (TCERG1) Human Gene Knockout Kit (CRISPR)
KN217192BN 1 Kit

CA150 (TCERG1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details