Recombinant Pongo abelii Tetraspanin-31 (TSPAN31)
This Recombinant Pongo abelii Tetraspanin-31 (TSPAN31) spans the amino acid sequence from region 1-210.
Product Specifications
Product Name Alternative
Tetraspanin-31, Tspan-31, Sarcoma-amplified sequence homolog
UniProt
Q5RAP8
Expression Region
1-210
Origin
Pongo abelii (Sumatran orangutan)
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MVCGGFACSKNALCALNVVYMLVSLLLIGVAAWGKGLGLVSSIHIIGGVIAVGVFLLLIA VAGLVGAVNHHQVLLFFYMIILGLVFIFQFVISCSCLAINRSKQADVINASWWVMSNKTR DELERSFDCCGLFNLTTLYQQDYDFCTAICKSQSPTCQMCGEKFLKYSDEALKILGGVGL FFSFTEILGVWLAMRFRNLKDPRANPSAFL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740225-500 1x 500 µL
Major Vault Protein (MVP) (1032), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470050-100 1x 100 µL
IgA Secretory Component (SC05), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880178-100 1x 100 µL
CD50 (ICAM-3) (186-2G9), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940883-100 1x 100 µL
PSA (Prostate Specific Antigen) (A67-B/E3), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details