Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida glabrata Protein SYM1 (SYM1)

This Recombinant Candida glabrata Protein SYM1 (SYM1) spans the amino acid sequence from region 1-210.

Product Specifications

Product Name Alternative

Protein SYM1

UniProt

Q6FXJ3

Expression Region

1-210

Origin

Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIRLFQLYEHQLKVRPKLTNSIMTGALFGIGDVSAQLLFPSGPDTLPPSAQTNDVKRGKY DIPRTVRAVVYGSMIFSFIGDRWYRFLTKVKFSNKPAKHWSNMVLRVCVDQLGFAPLGLP FYFGCMSLLEGHGLGAAREKIKLQWWDTLKTNWCVWPLFQMVNFSLVPLQHRLLAANVVA IFWNTFLSYTNSQIPVGGHKLTVQYPPTVQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytochrome p450 (M12P4H2), CF568 conjugate, 0.1mg/mL
BNC682199-100 1x 100 µL

Cytochrome p450 (M12P4H2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
UCHL5 Antibody
KC-27283-01 50 μL

UCHL5 Antibody

Sign In for Pricing
View Details
UCHL5 Antibody
KC-27283-02 100 µL

UCHL5 Antibody

Sign In for Pricing
View Details
UCHL5 Antibody
KC-27283-03 1 mL

UCHL5 Antibody

Sign In for Pricing
View Details
PHOS (PDC) Rabbit Polyclonal Antibody
TA362583 100 µL

PHOS (PDC) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Calcineurin A / PPP3CA (CALNA/2353), CF488A conjugate, 0.1mg/mL
BNC882353-100 1x 100 µL

Calcineurin A / PPP3CA (CALNA/2353), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details