Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tetraspanin-31 (Tspan31)

This Recombinant Mouse Tetraspanin-31 (Tspan31) spans the amino acid sequence from region 1-210.

Product Specifications

Product Name Alternative

Tetraspanin-31, Tspan-31, Sarcoma-amplified sequence homolog

UniProt

Q9CQ88

Expression Region

1-210

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVCGGFACSRNALCALNVVYMLVGFLLIGVAAWGKGLGVVSSIHIIGGVIAVGVFLLLIA VAGLVGAANHHQVLLFFYMIILGLVFIFQFGISCSCLAINRNTQADVINASWSVLSNSTR HELERSFDCCGLFNLTTLRLQDDTSCSAVCKTKSSTCQMCGERFLKHSDKALKILGGVGL FFSFTEILGVWLAMRFRNQKDPRANPSAFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VGAT shRNA Plasmid (h)
sc-61782-SH 20 µg

VGAT shRNA Plasmid (h)

Sign In for Pricing
View Details
Dracoflavan C2
380140 5 mg

Dracoflavan C2

Sign In for Pricing
View Details
Mouse mmu-miR-7648-3p miRNA Agomir
abx884335-01 5 nmol

Mouse mmu-miR-7648-3p miRNA Agomir

Sign In for Pricing
View Details
Mouse mmu-miR-7648-3p miRNA Agomir
abx884335-02 10 nmol

Mouse mmu-miR-7648-3p miRNA Agomir

Sign In for Pricing
View Details
OR7E122P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1539308 1.0 µg DNA

OR7E122P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
rno-miR-203b-3p miRNA Antagomir
MNR01279 2x 5.0 nmol

rno-miR-203b-3p miRNA Antagomir

Sign In for Pricing
View Details