Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Claudin-4 (Cldn4)

This Recombinant Mouse Claudin-4 (Cldn4) spans the amino acid sequence from region 1-210.

Product Specifications

Product Name Alternative

Claudin-4, Clostridium perfringens enterotoxin receptor, CPE-R, CPE-receptor

UniProt

O35054

Expression Region

1-210

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASMGLQVLGISLAVLGWLGIILSCALPMWRVTAFIGSNIVTAQTSWEGLWMNCVVQSTG QMQCKMYDSMLALPQDLQAARALMVISIIVGALGMLLSVVGGKCTNCMEDETVKAKIMIT AGAVFIVASMLIMVPVSWTAHNVIRDFYNPMVASGQKREMGASLYVGWAASGLLLLGGGL LCCSCPPRSNDKPYSAKYSAARSVPASNYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-MYPT1 (Ser509) Peptide
AF7105-BP 1 mg

Phospho-MYPT1 (Ser509) Peptide

Sign In for Pricing
View Details
KIN CytoSection
TS405689P5 25 Slides

KIN CytoSection

Sign In for Pricing
View Details
anti-JunB
YF-PA24032 50 ul

anti-JunB

Sign In for Pricing
View Details
Anti-Interleukin 5 (IL5) Polyclonal antibody
FY-AB34354-01 1 mL

Anti-Interleukin 5 (IL5) Polyclonal antibody

Sign In for Pricing
View Details
Anti-Interleukin 5 (IL5) Polyclonal antibody
FY-AB34354-02 100 µL

Anti-Interleukin 5 (IL5) Polyclonal antibody

Sign In for Pricing
View Details
Anti-Interleukin 5 (IL5) Polyclonal antibody
FY-AB34354-03 200 µL

Anti-Interleukin 5 (IL5) Polyclonal antibody

Sign In for Pricing
View Details