Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ywdD (ywdD)

This Recombinant Bacillus subtilis Uncharacterized protein ywdD (ywdD) spans the amino acid sequence from region 1-211.

Product Specifications

Product Name Alternative

Uncharacterized protein ywdD

UniProt

P39612

Expression Region

1-211

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDKETYVSEIKSGLKGLPEGEAMIEEIESHIEHHLFRSFQEGKSEEEAMQTLLQAFGTPT DIVSSFKKIQPVTFRAFLMFHLFCNSALFAVGIAITIMHVWLESPFVQAVWKGISVSVWL ILAAYMIYWVLIGYQGVKEFGKRGEKLVLHTILISMVPNVIFMLVFLFNVIPAALFQSLL TPWFVGTCAFATLLFPLFGRMGCYIGRRQLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyanamide
TRC-C952500-50G 50 g

Cyanamide

Sign In for Pricing
View Details
Human PYHIN1 activation kit by CRISPRa
GA115718 1 Kit

Human PYHIN1 activation kit by CRISPRa

Sign In for Pricing
View Details
Human CMPK2 activation kit by CRISPRa
GA115087 1 Kit

Human CMPK2 activation kit by CRISPRa

Sign In for Pricing
View Details
PE Anti-Human CD5 Antibody[UCHT2]
E-AB-F1041D-01 20 Tests

PE Anti-Human CD5 Antibody[UCHT2]

Sign In for Pricing
View Details
PE Anti-Human CD5 Antibody[UCHT2]
E-AB-F1041D-02 100 Tests

PE Anti-Human CD5 Antibody[UCHT2]

Sign In for Pricing
View Details
PE Anti-Human CD5 Antibody[UCHT2]
E-AB-F1041D-03 2x 100 Tests

PE Anti-Human CD5 Antibody[UCHT2]

Sign In for Pricing
View Details