Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome b6 (petB)

This Recombinant Cytochrome b6 (petB) spans the amino acid sequence from region 1-213.

Product Specifications

Product Name Alternative

Cytochrome b6

UniProt

Q9L598

Expression Region

1-213

Origin

Heliobacterium gestii

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKWLEERFPGIGHVAKDVADHPVPSHTLNIFFCLGGLTLLCFIVQCLTGIFLAFYYKPTP EAAFTSVQMITNEVRFGSVIRSMHHWSCQLMILLVFLHMLRVYYTGAFKRPRELNWVAGC FLLVLSLALAFTGYLLPYEQLSYWASVIGAETANTLPVVGPTLKIMMQGGIKVTAEMLSR FYVLHVMILPAVAIIFLVAHFIMIRVQGISDPM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KAPCB Antibody
8C10453-AAT 50 µg

KAPCB Antibody

Sign In for Pricing
View Details
Nucleostemin (GNL3) (C-term) Rabbit Polyclonal Antibody
AP11354PU-N 400 µL

Nucleostemin (GNL3) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human ITLN1 activation kit by CRISPRa
GA110811 1 Kit

Human ITLN1 activation kit by CRISPRa

Sign In for Pricing
View Details
m-Hydroxyhippuric Acid-13C2, 15N
TRC-H943127-1MG 1 mg

m-Hydroxyhippuric Acid-13C2, 15N

Sign In for Pricing
View Details
eIF1A (EIF1AX) (NM_001412) Human Over-expression Lysate
LC419951 20 µg

eIF1A (EIF1AX) (NM_001412) Human Over-expression Lysate

Sign In for Pricing
View Details
PRKACA (N-term) Rabbit Polyclonal Antibody
AP17667PU-N 400 µL

PRKACA (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details