Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pyogenes serotype M3 Glycerol-3-phosphate acyltransferase (plsY)

This Recombinant Streptococcus pyogenes serotype M3 Glycerol-3-phosphate acyltransferase (plsY) spans the amino acid sequence from region 1-213.

Product Specifications

Product Name Alternative

Glycerol-3-phosphate acyltransferase, Acyl-PO4 G3P acyltransferase, Acyl-phosphate--glycerol-3-phosphate acyltransferase, G3P acyltransferase, GPAT, EC= 2.3.1.n3, Lysophosphati

UniProt

P0DD11

Expression Region

1-213

Origin

Streptococcus pyogenes serotype M3 (strain SSI-1)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKLLLFITIAYLLGSIPTGLWIGQYFYHINLREHGSGNTGTTNTFRILGVKAGTATLAID MFKGTLSILLPIIFGMTSISSIAIGFFAVLGHTFPIFANFKGGKAVATSAGVLLGFAPLY LFFLASIFVLVLYLFSMISLASVVSAIVGVLSVLTFPAIHFLLPNYDYFLTFIVILLAFI IIIRHKDNISRIKHHTENLIPWGLNLSKQVPKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MART-1 / Melan-A (M2-9E3), 1mg/mL
BNUM0010-50 1x 50 µL

MART-1 / Melan-A (M2-9E3), 1mg/mL

Sign In for Pricing
View Details
Bcl-2 (BCL2/782), CF405S conjugate, 0.1mg/mL
BNC040782-500 1x 500 µL

Bcl-2 (BCL2/782), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Agxt Mouse Gene Knockout Kit (CRISPR)
KN501003 1 Kit

Agxt Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1,5-Di-O-acetyl-2,3-isopropylidene-D-ribose
TRC-D347500-1G 1 g

1,5-Di-O-acetyl-2,3-isopropylidene-D-ribose

Sign In for Pricing
View Details
Recombinant Mouse HER4/ErbB4 Protein (His Tag)
PKSM040374 100 µg

Recombinant Mouse HER4/ErbB4 Protein (His Tag)

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS705951 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details