Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pyogenes serotype M3 Glycerol-3-phosphate acyltransferase (plsY)

This Recombinant Streptococcus pyogenes serotype M3 Glycerol-3-phosphate acyltransferase (plsY) spans the amino acid sequence from region 1-213.

Product Specifications

Product Name Alternative

Glycerol-3-phosphate acyltransferase, Acyl-PO4 G3P acyltransferase, Acyl-phosphate--glycerol-3-phosphate acyltransferase, G3P acyltransferase, GPAT, EC= 2.3.1.n3, Lysophosphati

UniProt

P0DD11

Expression Region

1-213

Origin

Streptococcus pyogenes serotype M3 (strain SSI-1)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKLLLFITIAYLLGSIPTGLWIGQYFYHINLREHGSGNTGTTNTFRILGVKAGTATLAID MFKGTLSILLPIIFGMTSISSIAIGFFAVLGHTFPIFANFKGGKAVATSAGVLLGFAPLY LFFLASIFVLVLYLFSMISLASVVSAIVGVLSVLTFPAIHFLLPNYDYFLTFIVILLAFI IIIRHKDNISRIKHHTENLIPWGLNLSKQVPKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lgals12 Rabbit Polyclonal Antibody
TA363397 100 µL

Lgals12 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Granzyme B (NK/T-Cell Lymphoma Marker) (GZMB/3056), CF647 conjugate, 0.1mg/mL
BNC473056-100 1x 100 µL

Granzyme B (NK/T-Cell Lymphoma Marker) (GZMB/3056), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACV1B Antibody
8C10576-AAT 50 µg

ACV1B Antibody

Sign In for Pricing
View Details
Ksp-Cadherin / CDH16 (Renal Cell Marker) (CDH16/2448), CF647 conjugate, 0.1mg/mL
BNC472448-100 1x 100 µL

Ksp-Cadherin / CDH16 (Renal Cell Marker) (CDH16/2448), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant TMEM67 Antibody
RC-5796-01 50 μL

Recombinant TMEM67 Antibody

Sign In for Pricing
View Details
Recombinant TMEM67 Antibody
RC-5796-02 100 µL

Recombinant TMEM67 Antibody

Sign In for Pricing
View Details