Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized membrane protein ML0467 (ML0467)

This Recombinant Uncharacterized membrane protein ML0467 (ML0467) spans the amino acid sequence from region 1-214.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein ML0467

UniProt

Q49642

Expression Region

1-214

Origin

Mycobacterium leprae

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDVDALLQSIPPLAVYLLVSGVVGVESLGIPLPGEVVLVSAALLSSRHDLAVSSIGVGVV AVIGAAVGDSIGYAIGRRFGMPLFDHLGRRFPKHFGPGHVALVERLFNRWGVRAVFFGRF IALLRILAGPLAGALKMHYPRFLAANVSGAICWAGGTTALVYFAGMAAERWMERFSWIAL IITVVVGIIAAILLRERTSRIIAELEMEYKNRRH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD38, Mouse (HEK293, His)
HY-P72732-01 10 µg

CD38, Mouse (HEK293, His)

Sign In for Pricing
View Details
CD38, Mouse (HEK293, His)
HY-P72732-02 50 µg

CD38, Mouse (HEK293, His)

Sign In for Pricing
View Details
Anti-NR1D2 Antibody Picoband
MBS1758550-01 0.01 mg

Anti-NR1D2 Antibody Picoband

Sign In for Pricing
View Details
Anti-NR1D2 Antibody Picoband
MBS1758550-02 0.1 mg (Carrier Free)

Anti-NR1D2 Antibody Picoband

Sign In for Pricing
View Details
Anti-NR1D2 Antibody Picoband
MBS1758550-03 0.1 mg

Anti-NR1D2 Antibody Picoband

Sign In for Pricing
View Details
Anti-NR1D2 Antibody Picoband
MBS1758550-04 0.1 mg (Cy3)

Anti-NR1D2 Antibody Picoband

Sign In for Pricing
View Details