Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactococcus lactis subsp. cremoris Alkaline phosphatase-like protein (apl)

This Recombinant Lactococcus lactis subsp. cremoris Alkaline phosphatase-like protein (apl) spans the amino acid sequence from region 1-214.

Product Specifications

Product Name Alternative

Alkaline phosphatase-like protein

UniProt

Q48630

Expression Region

1-214

Origin

Lactococcus lactis subsp. cremoris (strain MG1363)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQEIIIQVMNQFGYFGVAFLIMIENIFPPIPSEVILTFGGFMTTYSELGIIGMIIAATIG SVLGALILYFVGRLLSVERLERLVSGRLGKVLRLKPEDITKAEKWFLKRGYATIFFCRFI PLIRSLISVPAGSAKMKLPSFLILTTLGTLIWNIVLVSLGAALGDNWEMIAGILDSYSSV VVAILGVIFILGLLLFVKKRFFPKNKNYSPDSEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant RSV Fusion protein / RSV-F (Strain RSS-2) Protein (His Tag)
PKSV030232 100 µg

Recombinant RSV Fusion protein / RSV-F (Strain RSS-2) Protein (His Tag)

Sign In for Pricing
View Details
CREB1 Antibody
KC-898-01 50 μL

CREB1 Antibody

Sign In for Pricing
View Details
CREB1 Antibody
KC-898-02 100 µL

CREB1 Antibody

Sign In for Pricing
View Details
CREB1 Antibody
KC-898-03 1 mL

CREB1 Antibody

Sign In for Pricing
View Details
Euscaphic Acid
TRC-E939500-1MG 1 mg

Euscaphic Acid

Sign In for Pricing
View Details
Slc30a9 Mouse Gene Knockout Kit (CRISPR)
KN516046 1 Kit

Slc30a9 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details