Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactococcus lactis subsp. cremoris Alkaline phosphatase-like protein (apl)

This Recombinant Lactococcus lactis subsp. cremoris Alkaline phosphatase-like protein (apl) spans the amino acid sequence from region 1-214.

Product Specifications

Product Name Alternative

Alkaline phosphatase-like protein

UniProt

Q48630

Expression Region

1-214

Origin

Lactococcus lactis subsp. cremoris (strain MG1363)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQEIIIQVMNQFGYFGVAFLIMIENIFPPIPSEVILTFGGFMTTYSELGIIGMIIAATIG SVLGALILYFVGRLLSVERLERLVSGRLGKVLRLKPEDITKAEKWFLKRGYATIFFCRFI PLIRSLISVPAGSAKMKLPSFLILTTLGTLIWNIVLVSLGAALGDNWEMIAGILDSYSSV VVAILGVIFILGLLLFVKKRFFPKNKNYSPDSEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IDUA (NM_000203) Human Over-expression Lysate
LC424864 20 µg

IDUA (NM_000203) Human Over-expression Lysate

Sign In for Pricing
View Details
FHL2 (NM_001039492) Human Over-expression Lysate
LY422060 100 µg

FHL2 (NM_001039492) Human Over-expression Lysate

Sign In for Pricing
View Details
ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2046), Biotin conjugate, 0.1mg/mL
BNCB2046-500 1x 500 µL

ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2046), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Catalase (CAT) Activity Assay Kit
E-BC-K031-M-01 48 T (16 samples)

Catalase (CAT) Activity Assay Kit

Sign In for Pricing
View Details
Catalase (CAT) Activity Assay Kit
E-BC-K031-M-02 96 T (40 samples)

Catalase (CAT) Activity Assay Kit

Sign In for Pricing
View Details
D aspartate oxidase (DDO) (NM_004032) Human Recombinant Protein
TP761486 50 µg

D aspartate oxidase (DDO) (NM_004032) Human Recombinant Protein

Sign In for Pricing
View Details