Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactococcus lactis subsp. cremoris Alkaline phosphatase-like protein (apl)

This Recombinant Lactococcus lactis subsp. cremoris Alkaline phosphatase-like protein (apl) spans the amino acid sequence from region 1-214.

Product Specifications

Product Name Alternative

Alkaline phosphatase-like protein

UniProt

Q48630

Expression Region

1-214

Origin

Lactococcus lactis subsp. cremoris (strain MG1363)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQEIIIQVMNQFGYFGVAFLIMIENIFPPIPSEVILTFGGFMTTYSELGIIGMIIAATIG SVLGALILYFVGRLLSVERLERLVSGRLGKVLRLKPEDITKAEKWFLKRGYATIFFCRFI PLIRSLISVPAGSAKMKLPSFLILTTLGTLIWNIVLVSLGAALGDNWEMIAGILDSYSSV VVAILGVIFILGLLLFVKKRFFPKNKNYSPDSEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Endometriotic tissue
CS506341 5x 5 µm

Frozen Tissue Sections, Endometriotic tissue

Sign In for Pricing
View Details
Triethylamine Hydrochloride
TRC-T775745-25G 25 g

Triethylamine Hydrochloride

Sign In for Pricing
View Details
alpha 1b Adrenergic Receptor (ADRA1B) Rabbit Polyclonal Antibody
AP06789PU-N 100 µg

alpha 1b Adrenergic Receptor (ADRA1B) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Porcine Angiopoietin 1 (ANGPT1) ELISA Kit
RDR-ANGPT1-p-01 96 Tests

Porcine Angiopoietin 1 (ANGPT1) ELISA Kit

Sign In for Pricing
View Details
Porcine Angiopoietin 1 (ANGPT1) ELISA Kit
RDR-ANGPT1-p-02 48 Tests

Porcine Angiopoietin 1 (ANGPT1) ELISA Kit

Sign In for Pricing
View Details
NONO (NM_007363) Human Over-expression Lysate
LY402135 100 µg

NONO (NM_007363) Human Over-expression Lysate

Sign In for Pricing
View Details