Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlorella vulgaris Cytochrome b6 (petB)

This Recombinant Chlorella vulgaris Cytochrome b6 (petB) spans the amino acid sequence from region 1-215.

Product Specifications

Product Name Alternative

Cytochrome b6

UniProt

P56321

Expression Region

1-215

Origin

Chlorella vulgaris (Green alga)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGKVYDWFEERLEIQSIADDISSKYVPPHVNIFYCIGGITFTCFLVQVATGFAMTFYYRP TVAEAFASVQYIMTEVNFGWLIRSIHRWSASMMVLMMILHVCRVYLTGGFKKPRELTWVT GVIMAVCTVSFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVVGPALVELLRGGVGVGQSTL TRFYSLHTFVLPLATAVFMLMHFLMIRKQGISGPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (RIV11), CF555 conjugate, 0.1mg/mL
BNC550333-100 1x 100 µL

CD8 (RIV11), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL
BNC470977-100 1x 100 µL

TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL
BNC470806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Endoglin / CD105 (ENG/1621), CF405S conjugate, 0.1mg/mL
BNC041621-500 1x 500 µL

Endoglin / CD105 (ENG/1621), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P57 / KIP2 (KP10 + KIP2/880), CF647 conjugate, 0.1mg/mL
BNC471015-100 1x 100 µL

P57 / KIP2 (KP10 + KIP2/880), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
UACA / Nucling (UACA/1222), CF568 conjugate, 0.1mg/mL
BNC681222-100 1x 100 µL

UACA / Nucling (UACA/1222), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details