Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Spinacia oleracea Cytochrome b6 (petB)

This Recombinant Spinacia oleracea Cytochrome b6 (petB) spans the amino acid sequence from region 1-215.

Product Specifications

Product Name Alternative

Cytochrome b6

UniProt

P00165

Expression Region

1-215

Origin

Spinacia oleracea (Spinach)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP TVTDAFASVQYIMTEVNFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVVLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H1 (AE-4), CF594 conjugate, 0.1mg/mL
BNC940096-500 1x 500 µL

Histone H1 (AE-4), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF647 conjugate, 0.1mg/mL
BNC470204-100 1x 100 µL

Complement C4d (C4D204), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF594 conjugate, 0.1mg/mL
BNC940449-500 1x 500 µL

CD104 (UM-A9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF640R conjugate, 0.1mg/mL
BNC400645-100 1x 100 µL

FOXP3 (3G3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (KRT8/803 + KRT18/835), CF740 conjugate, 0.1mg/mL
BNC740979-500 1x 500 µL

Cytokeratin 8/18 (KRT8/803 + KRT18/835), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgM Immunoglobulin (Cocktail), CF568 conjugate, 0.1mg/mL
BNC680762-100 1x 100 µL

IgM Immunoglobulin (Cocktail), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details