Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Marchantia polymorpha Cytochrome b6 (petB)

This Recombinant Marchantia polymorpha Cytochrome b6 (petB) spans the amino acid sequence from region 1-215.

Product Specifications

Product Name Alternative

Cytochrome b6

UniProt

P06248

Expression Region

1-215

Origin

Marchantia polymorpha (Liverwort) (Marchantia aquatica)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP TVTEAFSSVQYIMTEVNFGWLIRSVHRWSASMMVLMMILHIFRVYLTGGFKKPRELTWVT GVILAVLTVSFGVTGYSLPWDQIGYWAVKIVTGVPEAIPIIGSPLVELLRGSVSVGQSTL TRFYSLHTFVLPLLTAIFMLMHFLMIRKQGISGPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Argonaute 2 (AGO2) Human Gene Knockout Kit (CRISPR)
KN218078BN 1 Kit

Argonaute 2 (AGO2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DDR2 (NM_001014796) Human Over-expression Lysate
LY425366 100 µg

DDR2 (NM_001014796) Human Over-expression Lysate

Sign In for Pricing
View Details
3-(4'-Hydroxy)phenoxybenzoic Acid
TRC-H951225-100MG 100 mg

3-(4'-Hydroxy)phenoxybenzoic Acid

Sign In for Pricing
View Details
Human FGF Basic/FGF2, Tag Free
HA210834-01 20 µg

Human FGF Basic/FGF2, Tag Free

Sign In for Pricing
View Details
Human FGF Basic/FGF2, Tag Free
HA210834-02 50 µg

Human FGF Basic/FGF2, Tag Free

Sign In for Pricing
View Details
Human FGF Basic/FGF2, Tag Free
HA210834-03 100 µg

Human FGF Basic/FGF2, Tag Free

Sign In for Pricing
View Details