Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anabaena variabilis Cytochrome b6 (petB)

This Recombinant Anabaena variabilis Cytochrome b6 (petB) spans the amino acid sequence from region 1-215.

Product Specifications

Product Name Alternative

Cytochrome b6

UniProt

P0A385

Expression Region

1-215

Origin

Anabaena variabilis (strain ATCC 29413 / PCC 7937)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANVYDWFEERLEIQAIAEDVTSKYVPPHVNIFYCLGGITLVCFLIQFATGFAMTFYYKP TVAEAYSSVQYIMNEVNFGWLIRSIHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVS GVILAVITVSFGVTGYSLPWDQVGYWAVKIVSGVPEAIPVVGVLISDLLRGGSSVGQATL TRYYSAHTFVLPWLIAVFMLFHFLMIRKQGISGPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N1-Acetylspermine-d3 Trihydrochloride
TRC-A188007-1MG 1 mg

N1-Acetylspermine-d3 Trihydrochloride

Sign In for Pricing
View Details
Human SGK1 activation kit by CRISPRa
GA104387 1 Kit

Human SGK1 activation kit by CRISPRa

Sign In for Pricing
View Details
COMT Antibody
8C14991-AAT 50 µg

COMT Antibody

Sign In for Pricing
View Details
XFD350 acid
1786-AAT 5 mg

XFD350 acid

Sign In for Pricing
View Details
Human FGF-b ELISA Kit (48-well)
EA100085 48 Well

Human FGF-b ELISA Kit (48-well)

Sign In for Pricing
View Details
4-(4-Chlorophenyl)but-3-en-2-one
TRC-C994005-1G 1 g

4-(4-Chlorophenyl)but-3-en-2-one

Sign In for Pricing
View Details