What is the catalog number for Recombinant Uncharacterized protein YhiD (yhiD)?

The catalog number for Recombinant Uncharacterized protein YhiD (yhiD) is orb2918141.

What sizes are available for Recombinant Uncharacterized protein YhiD (yhiD)?

Recombinant Uncharacterized protein YhiD (yhiD) is available in the following size(s): 20 µg, 100 µg.

How many pack sizes does Recombinant Uncharacterized protein YhiD (yhiD) come in?

Recombinant Uncharacterized protein YhiD (yhiD) is available in 2 different pack sizes.

Is Recombinant Uncharacterized protein YhiD (yhiD) in stock?

Recombinant Uncharacterized protein YhiD (yhiD) is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant Uncharacterized protein YhiD (yhiD)

This Recombinant Uncharacterized protein YhiD (yhiD) spans the amino acid sequence from region 1-215.

Product Specifications

Product Name Alternative

Uncharacterized protein YhiD

UniProt

P0AFV3

Expression Region

1-215

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTAEFIIRLILAAIACGAIGMERQMRGKGAGLRTHVLIGMGSALFMIVSKYGFADVLSLD HVGLDPSRIAAQVVTGVGFIGAGNILVRNQNIVGLTTAADIWVTAAIGMVIGSGMYELGI YGSVMTLLVLEVFHQLTFRLMNKNYHLQLTLVNGNTVSMLDWFKQQKIKTDLVSLQENED HEVVAIDIQLHATTSIEDLLRLLKGMAGVKGVSIS