Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein YhiD (yhiD)

This Recombinant Uncharacterized protein YhiD (yhiD) spans the amino acid sequence from region 1-215.

Product Specifications

Product Name Alternative

Uncharacterized protein YhiD

UniProt

P0AFV3

Expression Region

1-215

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTAEFIIRLILAAIACGAIGMERQMRGKGAGLRTHVLIGMGSALFMIVSKYGFADVLSLD HVGLDPSRIAAQVVTGVGFIGAGNILVRNQNIVGLTTAADIWVTAAIGMVIGSGMYELGI YGSVMTLLVLEVFHQLTFRLMNKNYHLQLTLVNGNTVSMLDWFKQQKIKTDLVSLQENED HEVVAIDIQLHATTSIEDLLRLLKGMAGVKGVSIS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DC2 Protein (DC2) Rabbit anti-Human Polyclonal Antibody
GWB-9134EB 0.05 mg

DC2 Protein (DC2) Rabbit anti-Human Polyclonal Antibody

Sign In for Pricing
View Details
Anti-human IL-5 (Abgenix Anti-IL-5 Biosimilar)
BIO0667SM-5mg 5 mg

Anti-human IL-5 (Abgenix Anti-IL-5 Biosimilar)

Sign In for Pricing
View Details
Bad (m) -PR
sc-29779-PR 10 µM - 20 µL

Bad (m) -PR

Sign In for Pricing
View Details
Antifungal agent 1 2mg
A20307-2 2 mg

Antifungal agent 1 2mg

Sign In for Pricing
View Details
ARHGEF7 (Rho Guanine Nucleotide Exchange Factor 7, PAK-interacting Exchange Factor beta, Beta-Pix, COOL-1, p85, COOL1, KIAA0142, P85SPR, PAK3BP, PIXB, DKFZp686C12170, DKFZp761K1021, Nbla10314, P85SPR, PAK3BP, PIXB) (PE)
123514-PE 100 µL

ARHGEF7 (Rho Guanine Nucleotide Exchange Factor 7, PAK-interacting Exchange Factor beta, Beta-Pix, COOL-1, p85, COOL1, KIAA0142, P85SPR, PAK3BP, PIXB, DKFZp686C12170, DKFZp761K1021, Nbla10314, P85SPR, PAK3BP, PIXB) (PE)

Sign In for Pricing
View Details
Recombinant human DPP7 Protein, C-His (HEK293)
orb2328550-01 20 µg

Recombinant human DPP7 Protein, C-His (HEK293)

Sign In for Pricing
View Details