Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Phaeodactylum tricornutum Cytochrome b6 (petB)

This Recombinant Phaeodactylum tricornutum Cytochrome b6 (petB) spans the amino acid sequence from region 1-215.

Product Specifications

Product Name Alternative

Cytochrome b6

UniProt

A0T0B8

Expression Region

1-215

Origin

Phaeodactylum tricornutum (strain CCAP 1055/1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKVYDWFEERLEVQAIADDISSKYVPPHVNIFYCFGGLVLTCFLIQVATGFAMTFYYRP SVVDAFASVEYIMTSVNFGWLIRSIHRWSASMMVLMMVLHVFRVYLTGGFKKPRELTWVT GVTLSVVTVSFGVTGYSLPWDQVGFWACKIVTGVPAAVPIVGEPLVLILRGGESVGQSTL TRFYSAHTFVLPLAAAVLMLTHFLMIRKQGISGPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD100 (Semaphorin-4D) (A8), CF568 conjugate, 0.1mg/mL
BNC680218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL
BNC881081-100 1x 100 µL

CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/798), CF568 conjugate, 0.1mg/mL
BNC681917-100 1x 100 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/798), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, pan (Cocktail PAN-CK), CF543 conjugate, 0.1mg/mL
BNC430999-500 1x 500 µL

Cytokeratin, pan (Cocktail PAN-CK), CF543 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX10 (SOX10/991 + SOX10/1074), CF740 conjugate, 0.1mg/mL
BNC741074-500 1x 500 µL

SOX10 (SOX10/991 + SOX10/1074), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Golgi Complex (371-4), CF640R conjugate, 0.1mg/mL
BNC400102-500 1x 500 µL

Golgi Complex (371-4), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details