Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nostoc punctiforme Cytochrome b6 (petB)

This Recombinant Nostoc punctiforme Cytochrome b6 (petB) spans the amino acid sequence from region 1-215.

Product Specifications

Product Name Alternative

Cytochrome b6

UniProt

B2J5S9

Expression Region

1-215

Origin

Nostoc punctiforme (strain ATCC 29133 / PCC 73102)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANVYDWFEERLEIQALAEDVTSKYVPPHVNIFYCLGGITLVCFLIQFATGFAMTFYYRP TVTEAFSSVEYIMNEVNFGWLIRSIHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVS GVILAVITVSFGVTGYSLPWDQVGYWAVKIVSGVPEAIPVVGVLISDLLRGGSSVGQATL TRYYSAHTFVLPWLIAVFMLFHFLMIRKQGISGPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM131C Mouse Monoclonal Antibody [Clone ID: OTI6F3]
CF810728 100 µg

FAM131C Mouse Monoclonal Antibody [Clone ID: OTI6F3]

Sign In for Pricing
View Details
PC1/3 (PCSK1) (NM_000439) Human Over-expression Lysate
LC400155 20 µg

PC1/3 (PCSK1) (NM_000439) Human Over-expression Lysate

Sign In for Pricing
View Details
DPM2 Rabbit Polyclonal Antibody
TA361110 100 µL

DPM2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SPANXN4 (NM_001009613) Human Over-expression Lysate
LC422927 20 µg

SPANXN4 (NM_001009613) Human Over-expression Lysate

Sign In for Pricing
View Details
PICALM Human Gene Knockout Kit (CRISPR)
KN209057 1 Kit

PICALM Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Barium Carbonate
TRC-B127630-5G 5 g

Barium Carbonate

Sign In for Pricing
View Details