Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome b6 (petB)

This Recombinant Cytochrome b6 (petB) spans the amino acid sequence from region 1-215.

Product Specifications

Product Name Alternative

Cytochrome b6

UniProt

Q0P3P0

Expression Region

1-215

Origin

Ostreococcus tauri

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKVYNWFNERLEIQSIADDVTSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP TVTEAFASVQYIMTEVNFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVILSVITVSFGVTGYSLPWDQVGYWAVKIVTGVPDAIPVIGGFVVELLRGSVGVGQPTL TRFYSLHTFVLPLLAAVFMLMHFLMIRKQGISGPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZNF579 activation kit by CRISPRa
GA116069 1 Kit

Human ZNF579 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Blocks, Stomach
CB537536 1 Block

Frozen Tissue Blocks, Stomach

Sign In for Pricing
View Details
6-Phosphoglucono-Delta-lactone
TRC-P353740-1MG 1 mg

6-Phosphoglucono-Delta-lactone

Sign In for Pricing
View Details
2X AtTaq Master Mix, 100app
PLMM02 100 Applications

2X AtTaq Master Mix, 100app

Sign In for Pricing
View Details
(S)-Scoulerine
TRC-S200800-5MG 5 mg

(S)-Scoulerine

Sign In for Pricing
View Details
Recombinant Calpastatin Monoclonal Antibody
AN301454L-01 50 µL

Recombinant Calpastatin Monoclonal Antibody

Sign In for Pricing
View Details