Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome b6 (petB)

This Recombinant Cytochrome b6 (petB) spans the amino acid sequence from region 1-215.

Product Specifications

Product Name Alternative

Cytochrome b6

UniProt

Q1XDE6

Expression Region

1-215

Origin

Porphyra yezoensis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKIYDWFEERLEIQAIADDISSKYVPPHVNIFYCLGGIVFVSFLIQVATGFAMTFYYRP TVAEAFTSVEYIMTDVNFGWLIRSIHRWSVSMMVLMMILHVFRVYLTGGFKKPRELTWVT GVILGVLTVSFGVTGYSLPWDQIGYWAVKIVTGVPDAVPVVGASIVELLRGGVSVGQGTL TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Flutropium (bromide)
HY-106564A 1 Each

Flutropium (bromide)

Sign In for Pricing
View Details
Anti-Mouse CD31 (PECAM) PE
RM313170 50 Tests

Anti-Mouse CD31 (PECAM) PE

Sign In for Pricing
View Details
RNF216-IT1 Protein Vector (Human) (pPM-C-HA)
40294021 500 ng

RNF216-IT1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
DROSHA Rabbit Polyclonal Antibody
MBS9466497-01 0.05 mL

DROSHA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DROSHA Rabbit Polyclonal Antibody
MBS9466497-02 0.1 mL

DROSHA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DROSHA Rabbit Polyclonal Antibody
MBS9466497-03 5x 0.1 mL

DROSHA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details