What is the catalog number for Recombinant Synechococcus sp. Cytochrome b6 (petB)?

The catalog number for Recombinant Synechococcus sp. Cytochrome b6 (petB) is orb2918108.

What sizes are available for Recombinant Synechococcus sp. Cytochrome b6 (petB)?

Recombinant Synechococcus sp. Cytochrome b6 (petB) is available in the following size(s): 20 µg, 100 µg.

How many pack sizes does Recombinant Synechococcus sp. Cytochrome b6 (petB) come in?

Recombinant Synechococcus sp. Cytochrome b6 (petB) is available in 2 different pack sizes.

Is Recombinant Synechococcus sp. Cytochrome b6 (petB) in stock?

Recombinant Synechococcus sp. Cytochrome b6 (petB) is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant Synechococcus sp. Cytochrome b6 (petB)

This Recombinant Synechococcus sp. Cytochrome b6 (petB) spans the amino acid sequence from region 1-215.

Product Specifications

Product Name Alternative

Cytochrome b6

UniProt

Q2JTP0

Expression Region

1-215

Origin

Synechococcus sp. (strain JA-3-3Ab) (Cyanobacteria bacterium Yellowstone A-Prime)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKVYDWLDERLEITPFVDDATGKFIPPHVNIFYCLGGITLVCFLIQFATGFAMTFYYRP TVAEAFESVNYIMTQVNFGWLLRSIHRWSASMMVLMMILHTFRVYLTGGFKKPRELTWVT GVILAVLTVSFGVTGYSLPWDQVGYWAVKIVSGVPSAIPVVGDALVQLIRGGEAVGQATL TRFYSLHTFVLPWLTAVFMTMHFLMIRRQGISGPL