Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vesicle transport protein SFT2C (SFT2D3)

This Recombinant Human Vesicle transport protein SFT2C (SFT2D3) spans the amino acid sequence from region 1-215.

Product Specifications

Product Name Alternative

Vesicle transport protein SFT2C, SFT2 domain-containing protein 3

UniProt

Q587I9

Expression Region

1-215

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADLHRQLQEYLAQGKAGGPAAAEPLLAAEKAEEPGDRPAEEWLGRAGLRWTWARSPAES AAAGLTCLPSVTRGQRLAAGGGCLLLAALCFGLAALYAPVLLLRARKFALLWSLGSALAL AGSALLRGGAACGRLLRCEEAPSRPALLYMAALGATLFAALGLRSTLLTVLGAGAQVAAL LAALVGLLPWGGGTALRLALGRLGRGAGLAKVLPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENDURO™ 250V Power Supply, 120V
LE0203-120 1 Each

ENDURO™ 250V Power Supply, 120V

Sign In for Pricing
View Details
RPA2 Polyclonal Antibody
RD79438A-01 20 µL

RPA2 Polyclonal Antibody

Sign In for Pricing
View Details
RPA2 Polyclonal Antibody
RD79438A-02 60 μL

RPA2 Polyclonal Antibody

Sign In for Pricing
View Details
RPA2 Polyclonal Antibody
RD79438A-03 120 μL

RPA2 Polyclonal Antibody

Sign In for Pricing
View Details
RPA2 Polyclonal Antibody
RD79438A-04 200 µL

RPA2 Polyclonal Antibody

Sign In for Pricing
View Details
TS010
MBS5803984 Inquire

TS010

Sign In for Pricing
View Details