Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nymphaea alba Cytochrome b6 (petB)

This Recombinant Nymphaea alba Cytochrome b6 (petB) spans the amino acid sequence from region 1-215.

Product Specifications

Product Name Alternative

Cytochrome b6

UniProt

Q6EW22

Expression Region

1-215

Origin

Nymphaea alba (White water-lily) (Castalia alba)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFHCLGGITLTCFLVQVATGFAMTFYYRP TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPIVGSPLVELLRGSASVGQSTL TRFYSLHTFVLPLLTAVFMLMHFSMIRKQGISGPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUDT18 (NM_024815) Human Recombinant Protein
TP304376M 100 µg

NUDT18 (NM_024815) Human Recombinant Protein

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF740 conjugate, 0.1mg/mL
BNC740257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CA7 (NM_001014435) Human Over-expression Lysate
LY423060 100 µg

CA7 (NM_001014435) Human Over-expression Lysate

Sign In for Pricing
View Details
C7orf59 (LAMTOR4) (NM_001008395) Human Recombinant Protein
TP309099M 100 µg

C7orf59 (LAMTOR4) (NM_001008395) Human Recombinant Protein

Sign In for Pricing
View Details
Perforin-1 (Pore Forming Protein) (Apoptosis Marker) (PRF1/2467), CF594 conjugate, 0.1mg/mL
BNC942467-100 1x 100 µL

Perforin-1 (Pore Forming Protein) (Apoptosis Marker) (PRF1/2467), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
14 3 3 gamma (YWHAG) Human Knockdown Lysate
LY300318 100 µg

14 3 3 gamma (YWHAG) Human Knockdown Lysate

Sign In for Pricing
View Details