Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gloeobacter violaceus Cytochrome b6 (petB)

This Recombinant Gloeobacter violaceus Cytochrome b6 (petB) spans the amino acid sequence from region 1-215.

Product Specifications

Product Name Alternative

Cytochrome b6

UniProt

Q7NJB3

Expression Region

1-215

Origin

Gloeobacter violaceus (strain PCC 7421)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKVYDWFQERLEVQALADDITSKYVPPHVNIFYCLGGVTLICFLVQFATGFAMTYYYKP TVAEAFSSVNYIMDEVSFGWLIRSIHRWSASMMVLAMILHTFRVYLTGGFKRPRELTWVT GVLLACLTVSFGVTGYSLPWDQVGYWAVKIVTQVPSAIPVVGDLIVEFLRGGAGVGQETL TRFYSAHTFVLPWLTVVFMLMHFLMIRKQGISGPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neurogranin Recombinant Rabbit monoclonal Antibody
HA750851 100 µL

Neurogranin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Rat PINP (Procollagen Type I N-Terminal Propeptide) CLIA Kit
E-CL-R0732-01 24 Tests

Rat PINP (Procollagen Type I N-Terminal Propeptide) CLIA Kit

Sign In for Pricing
View Details
Rat PINP (Procollagen Type I N-Terminal Propeptide) CLIA Kit
E-CL-R0732-02 48 Tests

Rat PINP (Procollagen Type I N-Terminal Propeptide) CLIA Kit

Sign In for Pricing
View Details
Rat PINP (Procollagen Type I N-Terminal Propeptide) CLIA Kit
E-CL-R0732-03 96 Tests

Rat PINP (Procollagen Type I N-Terminal Propeptide) CLIA Kit

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1386), CF647 conjugate, 0.1mg/mL
BNC471386-500 1x 500 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1386), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
N-(Benzyloxycarbonyl)serine Benzyl Ester
TRC-B286770-5G 5 g

N-(Benzyloxycarbonyl)serine Benzyl Ester

Sign In for Pricing
View Details