Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gloeobacter violaceus Cytochrome b6 (petB)

This Recombinant Gloeobacter violaceus Cytochrome b6 (petB) spans the amino acid sequence from region 1-215.

Product Specifications

Product Name Alternative

Cytochrome b6

UniProt

Q7NJB3

Expression Region

1-215

Origin

Gloeobacter violaceus (strain PCC 7421)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKVYDWFQERLEVQALADDITSKYVPPHVNIFYCLGGVTLICFLVQFATGFAMTYYYKP TVAEAFSSVNYIMDEVSFGWLIRSIHRWSASMMVLAMILHTFRVYLTGGFKRPRELTWVT GVLLACLTVSFGVTGYSLPWDQVGYWAVKIVTQVPSAIPVVGDLIVEFLRGGAGVGQETL TRFYSAHTFVLPWLTVVFMLMHFLMIRKQGISGPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SnRK1alpha1 | SNF1-related protein kinase catalytic subunit alpha KIN10
AS21 4581 50 µg

Anti-SnRK1alpha1 | SNF1-related protein kinase catalytic subunit alpha KIN10

Sign In for Pricing
View Details
Human Cat Eye Syndrome Chromosome Region, Candidate 1 (CECR1) ELISA Kit
RDR-CECR1-Hu-01 96 Tests

Human Cat Eye Syndrome Chromosome Region, Candidate 1 (CECR1) ELISA Kit

Sign In for Pricing
View Details
Human Cat Eye Syndrome Chromosome Region, Candidate 1 (CECR1) ELISA Kit
RDR-CECR1-Hu-02 48 Tests

Human Cat Eye Syndrome Chromosome Region, Candidate 1 (CECR1) ELISA Kit

Sign In for Pricing
View Details
GRF2 (RAPGEF1) Human qPCR Primer Pair (NM_198679)
HP230320 200 Reactions

GRF2 (RAPGEF1) Human qPCR Primer Pair (NM_198679)

Sign In for Pricing
View Details
Vcan Mouse Gene Knockout Kit (CRISPR)
KN518868 1 Kit

Vcan Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Epicamphor
TRC-E882990-25MG 25 mg

Epicamphor

Sign In for Pricing
View Details