Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome b6 (petB)

This Recombinant Cytochrome b6 (petB) spans the amino acid sequence from region 1-215.

Product Specifications

Product Name Alternative

Cytochrome b6

UniProt

Q8M9Z4

Expression Region

1-215

Origin

Chaetosphaeridium globosum

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGKVYDWFEERLEIQAIADDISSKYVPPHVNIFYCLGGITFTSFVIQVASGFAMTFYYRP TVTEAFASVQYIMTEVNFGWLIRSVHRWSASMMVLMMILHIFRVYLTGGFKKPRELTWVT GVILSVLTVSFGVTGYSLPWDQVGYWAVKIVTGVPDAIPVIGSTVVELLRGSVSVGQSTL TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant DDX58 Antibody
RC-16676-01 50 μL

Recombinant DDX58 Antibody

Sign In for Pricing
View Details
Recombinant DDX58 Antibody
RC-16676-02 100 µL

Recombinant DDX58 Antibody

Sign In for Pricing
View Details
Recombinant DDX58 Antibody
RC-16676-03 1 mL

Recombinant DDX58 Antibody

Sign In for Pricing
View Details
Diethylphosphonoacetic Acid
TRC-D444745-50G 50 g

Diethylphosphonoacetic Acid

Sign In for Pricing
View Details
TBX3 Rabbit Polyclonal Antibody
TA371791 100 µL

TBX3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD122/IL-2RB Antibody[5H4]
E-AB-F1029M-01 50 Tests

Elab Fluor® 647 Anti-Mouse CD122/IL-2RB Antibody[5H4]

Sign In for Pricing
View Details