Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pyrophosphate-energized proton pump 2 (hppA2)

This Recombinant Pyrophosphate-energized proton pump 2 (hppA2) spans the amino acid sequence from region 1-215.

Product Specifications

Product Name Alternative

Pyrophosphate-energized proton pump 2, EC= 3.6.1.1, Membrane-bound proton-translocating pyrophosphatase 2, Pyrophosphate-energized inorganic pyrophosphatase 2, H (+) -PPase 2

UniProt

Q93AS1

Expression Region

1-215

Origin

Rhizobium leguminosarum bv. trifolii

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AAIFFAGTPILESAMVYPLAICGACILTSIAGTFFVKLGTNNSIMGALYKGLIATGVFSV AGLAVATYATVGWGTIGTVAGMEITGTNLFFCGLVGLVVTALIVVITEYYTGTNKRPVNS IAQASVTGHGTNVIQGLAVSLESTALPAIVIVGGIIGTYQLGGLFGTGIAVTAMLGLAGM IVALDAFGPVTDNAGGIAEMAGLDPDVRKRPTRWM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Salivary gland
CS639148 5x 5 µm

Frozen Tissue Sections, Salivary gland

Sign In for Pricing
View Details
Pid1 Mouse Gene Knockout Kit (CRISPR)
KN513259 1 Kit

Pid1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Slc8a3 Mouse Gene Knockout Kit (CRISPR)
KN516204 1 Kit

Slc8a3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PEX12 (Center) Rabbit Polyclonal Antibody
AP53259PU-N 400 µL

PEX12 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (rC3e/1931), Biotin conjugate, 0.1mg/mL
BNCB3644-500 1x 500 µL

CD3e (T-Cell Marker) (rC3e/1931), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AASDH Human qPCR Primer Pair (NM_181806)
HP219027 200 Reactions

AASDH Human qPCR Primer Pair (NM_181806)

Sign In for Pricing
View Details