Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pyrophosphate-energized proton pump 2 (hppA2)

This Recombinant Pyrophosphate-energized proton pump 2 (hppA2) spans the amino acid sequence from region 1-215.

Product Specifications

Product Name Alternative

Pyrophosphate-energized proton pump 2, EC= 3.6.1.1, Membrane-bound proton-translocating pyrophosphatase 2, Pyrophosphate-energized inorganic pyrophosphatase 2, H (+) -PPase 2

UniProt

Q93AS1

Expression Region

1-215

Origin

Rhizobium leguminosarum bv. trifolii

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AAIFFAGTPILESAMVYPLAICGACILTSIAGTFFVKLGTNNSIMGALYKGLIATGVFSV AGLAVATYATVGWGTIGTVAGMEITGTNLFFCGLVGLVVTALIVVITEYYTGTNKRPVNS IAQASVTGHGTNVIQGLAVSLESTALPAIVIVGGIIGTYQLGGLFGTGIAVTAMLGLAGM IVALDAFGPVTDNAGGIAEMAGLDPDVRKRPTRWM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VGLUT2 Polyclonal Guinea pig antiserum
135 404 100 µL

VGLUT2 Polyclonal Guinea pig antiserum

Sign In for Pricing
View Details
Ndufs8 (NM_144870) Mouse Tagged ORF Clone
MG202305 10 µg

Ndufs8 (NM_144870) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Mouse VEGF R2/Flk-1 Protein (Fc Tag)
PDMM100186-01 20 µg

Recombinant Mouse VEGF R2/Flk-1 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse VEGF R2/Flk-1 Protein (Fc Tag)
PDMM100186-02 100 µg

Recombinant Mouse VEGF R2/Flk-1 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse VEGF R2/Flk-1 Protein (Fc Tag)
PDMM100186-03 500 µg

Recombinant Mouse VEGF R2/Flk-1 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse VEGF R2/Flk-1 Protein (Fc Tag)
PDMM100186-04 1 mg

Recombinant Mouse VEGF R2/Flk-1 Protein (Fc Tag)

Sign In for Pricing
View Details