Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pyrophosphate-energized proton pump 2 (hppA2)

This Recombinant Pyrophosphate-energized proton pump 2 (hppA2) spans the amino acid sequence from region 1-215.

Product Specifications

Product Name Alternative

Pyrophosphate-energized proton pump 2, EC= 3.6.1.1, Membrane-bound proton-translocating pyrophosphatase 2, Pyrophosphate-energized inorganic pyrophosphatase 2, H (+) -PPase 2

UniProt

Q93AS1

Expression Region

1-215

Origin

Rhizobium leguminosarum bv. trifolii

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AAIFFAGTPILESAMVYPLAICGACILTSIAGTFFVKLGTNNSIMGALYKGLIATGVFSV AGLAVATYATVGWGTIGTVAGMEITGTNLFFCGLVGLVVTALIVVITEYYTGTNKRPVNS IAQASVTGHGTNVIQGLAVSLESTALPAIVIVGGIIGTYQLGGLFGTGIAVTAMLGLAGM IVALDAFGPVTDNAGGIAEMAGLDPDVRKRPTRWM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBXAS1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B8]
TA501364AM 100 µL

TBXAS1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B8]

Sign In for Pricing
View Details
NIRF (UHRF2) (NM_152896) Human Recombinant Protein
TP319579L 1 mg

NIRF (UHRF2) (NM_152896) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Mouse Wnt Inhibitory Factor 1/WIF1 Protein (His Tag)
PKSM040406 100 µg

Recombinant Mouse Wnt Inhibitory Factor 1/WIF1 Protein (His Tag)

Sign In for Pricing
View Details
Tissue FFPE Sections, Small intestine
CS803812 5x 5 µm

Tissue FFPE Sections, Small intestine

Sign In for Pricing
View Details
Caspase-1 Recombinant Rabbit Monoclonal Antibody [SU40-07]
ET1608-69 100 µL

Caspase-1 Recombinant Rabbit Monoclonal Antibody [SU40-07]

Sign In for Pricing
View Details
IL 11 Human
OM296766-01 10 µg

IL 11 Human

Sign In for Pricing
View Details