Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome b6 (petB)

This Recombinant Cytochrome b6 (petB) spans the amino acid sequence from region 1-215.

Product Specifications

Product Name Alternative

Cytochrome b6

UniProt

Q9BBQ6

Expression Region

1-215

Origin

Lotus japonicus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVVLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSSVVELLRGSASVGQSTL TRFYSLHTFVLPLLTAVFMLMHFSMIRKQGISGPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Asphd2 ELISA KIT
ELI-11337m 96 Tests

Mouse Asphd2 ELISA KIT

Sign In for Pricing
View Details
Human 5'-nucleotidase domain-containing protein 2 (NT5DC2) ELISA Kit
abx536014 96 Tests

Human 5'-nucleotidase domain-containing protein 2 (NT5DC2) ELISA Kit

Sign In for Pricing
View Details
Non-structural glycoprotein 4 Antibody
orb862926 2 mg

Non-structural glycoprotein 4 Antibody

Sign In for Pricing
View Details
KRTAP5-2 Recombinant Protein (Mouse)
RP146666 100 µg

KRTAP5-2 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
ZNF202, ID (ZNF202, ZKSCAN10, Zinc finger protein 202, Zinc finger protein with KRAB and SCAN domains 10) (MaxLight 550) discontinued
044148-ML550 100 µL

ZNF202, ID (ZNF202, ZKSCAN10, Zinc finger protein 202, Zinc finger protein with KRAB and SCAN domains 10) (MaxLight 550) discontinued

Sign In for Pricing
View Details
PPAR-Gamma Monoclonal Antibody
JOT-MCA1053-01 20 µL

PPAR-Gamma Monoclonal Antibody

Sign In for Pricing
View Details