Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nephroselmis olivacea Cytochrome b6 (petB)

This Recombinant Nephroselmis olivacea Cytochrome b6 (petB) spans the amino acid sequence from region 1-215.

Product Specifications

Product Name Alternative

Cytochrome b6

UniProt

Q9TL31

Expression Region

1-215

Origin

Nephroselmis olivacea (Green alga)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKIYDWFEERLEIQAIADDITSKYVPPHVNIFYCFGGITLTCFLIQVATGFAMTFYYRP TVTEAFASVEYIMTNVNFGWLIRSIHRWSASMMVMMLILHVFRVYLTGGFKKPRELTWVT GVILAVITVSFGVTGYSLPWDQVGYWAVKIVTGVPDAIPVIGAPLVELLRGSVSVGQSTL TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-HT-2B Antibody
8C12014-AAT 50 µg

5-HT-2B Antibody

Sign In for Pricing
View Details
Quabodepistat
TRC-Q757740-10MG 10 mg

Quabodepistat

Sign In for Pricing
View Details
Mouse Drd1 activation kit by CRISPRa
GA201124 1 Kit

Mouse Drd1 activation kit by CRISPRa

Sign In for Pricing
View Details
Tmem82 Mouse Gene Knockout Kit (CRISPR)
KN517904 1 Kit

Tmem82 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Vgl4 (VGLL4) (NM_001128219) Human Over-expression Lysate
LC426931 20 µg

Vgl4 (VGLL4) (NM_001128219) Human Over-expression Lysate

Sign In for Pricing
View Details
Myocilin (MYOC) Human Gene Knockout Kit (CRISPR)
KN206556BN 1 Kit

Myocilin (MYOC) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details