Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Claudin-7-B (cldn7b)

This Recombinant Danio rerio Claudin-7-B (cldn7b) spans the amino acid sequence from region 1-215.

Product Specifications

Product Name Alternative

Claudin-7-B, Claudin-like protein ZF4A22

UniProt

Q9YH92

Expression Region

1-215

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAHKGLQLLGFTLSLLGLIGLIIGTIMPQWKMSAYVGDNIITAIAMYQGLWMSCAYQSTG QQQCKVYDSVLQLDSALQATRALMVVAILLTVAGLGVASMGMKCTNCGGDDKVKKSRIAM TGGIILSVGALCSIVACGWFTSQIIRDFYNPFTPVNTKYEFGAAIFIAWAGAFLDIMGGG MLASSCSKGQSSPNYPKSSRPVKSSRPPSSSKEYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Prostate
CS501090 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
D-Threitol
TRC-T400023-25MG 25 mg

D-Threitol

Sign In for Pricing
View Details
Human NOXO1 activation kit by CRISPRa
GA114828 1 Kit

Human NOXO1 activation kit by CRISPRa

Sign In for Pricing
View Details
CD2 / Lymphocyte Function Antigen 2 (LFA-2) (UMCD2), CF594 conjugate, 0.1mg/mL
BNC940201-100 1x 100 µL

CD2 / Lymphocyte Function Antigen 2 (LFA-2) (UMCD2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human OR2W3 activation kit by CRISPRa
GA117567 1 Kit

Human OR2W3 activation kit by CRISPRa

Sign In for Pricing
View Details
AKT1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G5]
TA504238AM 100 µL

AKT1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G5]

Sign In for Pricing
View Details