Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Claudin-7-B (cldn7b)

This Recombinant Danio rerio Claudin-7-B (cldn7b) spans the amino acid sequence from region 1-215.

Product Specifications

Product Name Alternative

Claudin-7-B, Claudin-like protein ZF4A22

UniProt

Q9YH92

Expression Region

1-215

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAHKGLQLLGFTLSLLGLIGLIIGTIMPQWKMSAYVGDNIITAIAMYQGLWMSCAYQSTG QQQCKVYDSVLQLDSALQATRALMVVAILLTVAGLGVASMGMKCTNCGGDDKVKKSRIAM TGGIILSVGALCSIVACGWFTSQIIRDFYNPFTPVNTKYEFGAAIFIAWAGAFLDIMGGG MLASSCSKGQSSPNYPKSSRPVKSSRPPSSSKEYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mix-n-StainTM CF®594 Antibody Labeling Kit, 1x (20-50ug) labeling
#92256 1 Kit

Mix-n-StainTM CF®594 Antibody Labeling Kit, 1x (20-50ug) labeling

Sign In for Pricing
View Details
Syf2 Mouse Gene Knockout Kit (CRISPR)
KN517044 1 Kit

Syf2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD34 (ICO-115), CF555 conjugate, 0.1mg/mL
BNC550039-500 1x 500 µL

CD34 (ICO-115), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Phosphotyrosine (P-Tyr) (PY2870R), CF568 conjugate, 0.1mg/mL
BNC682870-500 1x 500 µL

Phosphotyrosine (P-Tyr) (PY2870R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DuoClick™ Screw-Cap Culture Tubes
T8842 500 Units/Case

DuoClick™ Screw-Cap Culture Tubes

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: right
CS505845 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details